HAPLN2 polyclonal antibody (A01)
  • HAPLN2 polyclonal antibody (A01)

HAPLN2 polyclonal antibody (A01)

Ref: AB-H00060484-A01
HAPLN2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HAPLN2.
Información adicional
Size 50 uL
Gene Name HAPLN2
Gene Alias BRAL1
Gene Description hyaluronan and proteoglycan link protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRLEDEGRYRCELINGIEDESVALT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HAPLN2 (NP_068589, 31 a.a. ~ 142 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 60484

Enviar uma mensagem


HAPLN2 polyclonal antibody (A01)

HAPLN2 polyclonal antibody (A01)