CDH26 monoclonal antibody (M04), clone 6C10
  • CDH26 monoclonal antibody (M04), clone 6C10

CDH26 monoclonal antibody (M04), clone 6C10

Ref: AB-H00060437-M04
CDH26 monoclonal antibody (M04), clone 6C10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CDH26.
Información adicional
Size 100 ug
Gene Name CDH26
Gene Alias VR20
Gene Description cadherin-like 26
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MKPLIWTWSDVEGQRPALLICTAAAGPTQGVKDLEEVPPSAASQSAQARCALGSWGYGKPFEPRSVKNIHSTPAYPDATMHRQLLAPVEGRMAETLNQKLHVANVLEDDPGYLPHVYSEEGECGGAPSLSSLASLEQELQPDLLDSLGSKATPFEEIYSESGVPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDH26 (NP_068582.2, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 60437
Clone Number 6C10
Iso type IgG2b Kappa

Enviar uma mensagem


CDH26 monoclonal antibody (M04), clone 6C10

CDH26 monoclonal antibody (M04), clone 6C10