TGIF2 monoclonal antibody (M15), clone 2A4
  • TGIF2 monoclonal antibody (M15), clone 2A4

TGIF2 monoclonal antibody (M15), clone 2A4

Ref: AB-H00060436-M15
TGIF2 monoclonal antibody (M15), clone 2A4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant TGIF2.
Información adicional
Size 100 ug
Gene Name TGIF2
Gene Alias -
Gene Description TGFB-induced factor homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TGIF2 (AAH12816, 1 a.a. ~ 237 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 60436
Clone Number 2A4
Iso type IgG2b Kappa

Enviar uma mensagem


TGIF2 monoclonal antibody (M15), clone 2A4

TGIF2 monoclonal antibody (M15), clone 2A4