TGIF2 purified MaxPab rabbit polyclonal antibody (D01P)
  • TGIF2 purified MaxPab rabbit polyclonal antibody (D01P)

TGIF2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00060436-D01P
TGIF2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TGIF2 protein.
Información adicional
Size 100 ug
Gene Name TGIF2
Gene Alias -
Gene Description TGFB-induced factor homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TGIF2 (NP_068581.1, 1 a.a. ~ 237 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 60436

Enviar uma mensagem


TGIF2 purified MaxPab rabbit polyclonal antibody (D01P)

TGIF2 purified MaxPab rabbit polyclonal antibody (D01P)