AVPI1 monoclonal antibody (M03), clone 1G3
  • AVPI1 monoclonal antibody (M03), clone 1G3

AVPI1 monoclonal antibody (M03), clone 1G3

Ref: AB-H00060370-M03
AVPI1 monoclonal antibody (M03), clone 1G3

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant AVPI1.
Información adicional
Size 100 ug
Gene Name AVPI1
Gene Alias PP5395|RP11-548K23.7|VIP32|VIT32
Gene Description arginine vasopressin-induced 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALKRLRRKRPPRQKPLGHSLHHCSRLRILEPHSALANPQSATETASSEQYLHSRKKSARIRRNWRKSGPTSYLHQIRH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AVPI1 (NP_068378.1, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 60370
Clone Number 1G3
Iso type IgG1 Kappa

Enviar uma mensagem


AVPI1 monoclonal antibody (M03), clone 1G3

AVPI1 monoclonal antibody (M03), clone 1G3