SIGIRR monoclonal antibody (M01A), clone 3H8-2G3
  • SIGIRR monoclonal antibody (M01A), clone 3H8-2G3

SIGIRR monoclonal antibody (M01A), clone 3H8-2G3

Ref: AB-H00059307-M01A
SIGIRR monoclonal antibody (M01A), clone 3H8-2G3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant SIGIRR.
Información adicional
Size 200 uL
Gene Name SIGIRR
Gene Alias MGC110992|TIR8
Gene Description single immunoglobulin and toll-interleukin 1 receptor (TIR) domain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHVAAVLASLLVLLALLLAALLYVKCRLNVLLWYQDAYGEVEINDGKLYDAYVSYSDCPEDRKFVNFILKPQLERRRGYKLFLDDRDLLPRAEPSADLLVNLSRCRRLIVVLSDAFLSRAWCSHSFREGLCRLLELTRR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIGIRR (AAH03591, 1 a.a. ~ 410 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 59307
Clone Number 3H8-2G3
Iso type IgM kappa

Enviar uma mensagem


SIGIRR monoclonal antibody (M01A), clone 3H8-2G3

SIGIRR monoclonal antibody (M01A), clone 3H8-2G3