SIGIRR MaxPab rabbit polyclonal antibody (D01)
  • SIGIRR MaxPab rabbit polyclonal antibody (D01)

SIGIRR MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00059307-D01
SIGIRR MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SIGIRR protein.
Información adicional
Size 100 uL
Gene Name SIGIRR
Gene Alias MGC110992|TIR8
Gene Description single immunoglobulin and toll-interleukin 1 receptor (TIR) domain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHVAAVLASLLVLLALLLAALLYVKCRLNVLLWYQDAYGEVEINDGKLYDAYVSYSDCPEDRKFVNFILKPQLERRRGYKLFLDDRDLLPRAEPSADLLVNLSRCRRLIVVLSDAFLSRAWCSHSFREGLCRLLELTRR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SIGIRR (NP_068577.1, 1 a.a. ~ 410 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 59307

Enviar uma mensagem


SIGIRR MaxPab rabbit polyclonal antibody (D01)

SIGIRR MaxPab rabbit polyclonal antibody (D01)