CACNG7 MaxPab rabbit polyclonal antibody (D01)
  • CACNG7 MaxPab rabbit polyclonal antibody (D01)

CACNG7 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00059284-D01
CACNG7 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CACNG7 protein.
Información adicional
Size 100 uL
Gene Name CACNG7
Gene Alias -
Gene Description calcium channel, voltage-dependent, gamma subunit 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWRVCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CACNG7 (NP_114102.2, 1 a.a. ~ 275 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 59284

Enviar uma mensagem


CACNG7 MaxPab rabbit polyclonal antibody (D01)

CACNG7 MaxPab rabbit polyclonal antibody (D01)