ENPP5 purified MaxPab rabbit polyclonal antibody (D01P)
  • ENPP5 purified MaxPab rabbit polyclonal antibody (D01P)

ENPP5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00059084-D01P
ENPP5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ENPP5 protein.
Información adicional
Size 100 ug
Gene Name ENPP5
Gene Alias KIAA0879
Gene Description ectonucleotide pyrophosphatase/phosphodiesterase 5 (putative function)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTSKFLLVSFILAALSLSTTFSLQPDQQKVLLVSFDGFRWDYLYKVPTPHFHYIMKYGVHVKQVTNVFITKTYPNHYTLVTGLFAENHGIVANDMFDPIRNKSFSLDHMNIYDSKFWEEATPIWITNQRAGHTSGAAMWPGTDVKIHKRFPTHYMPYNESVSFEDRVAKIIEWFTSKEPINLGLLYWEDPDDMGHHLGPDSPLMGPVISDIDKKLGYLIQMLKKAKLWNTLNLIITSDHGMTQCSEERLIELDQY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ENPP5 (NP_067547.1, 1 a.a. ~ 477 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 59084

Enviar uma mensagem


ENPP5 purified MaxPab rabbit polyclonal antibody (D01P)

ENPP5 purified MaxPab rabbit polyclonal antibody (D01P)