IL21 purified MaxPab rabbit polyclonal antibody (D01P)
  • IL21 purified MaxPab rabbit polyclonal antibody (D01P)

IL21 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00059067-D01P
IL21 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IL21 protein.
Información adicional
Size 100 ug
Gene Name IL21
Gene Alias IL-21|Za11
Gene Description interleukin 21
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,PLA-Ce
Immunogen Prot. Seq MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL21 (NP_068575.1, 1 a.a. ~ 162 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 59067

Enviar uma mensagem


IL21 purified MaxPab rabbit polyclonal antibody (D01P)

IL21 purified MaxPab rabbit polyclonal antibody (D01P)