MPP4 polyclonal antibody (A01)
  • MPP4 polyclonal antibody (A01)

MPP4 polyclonal antibody (A01)

Ref: AB-H00058538-A01
MPP4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MPP4.
Información adicional
Size 50 uL
Gene Name MPP4
Gene Alias ALS2CR5|DLG6
Gene Description membrane protein, palmitoylated 4 (MAGUK p55 subfamily member 4)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MIQSDKGADPPDKKDMKLSTATNPQNGLSQILRLVLQELSLFYSRDVNGVCLLYDLLHSPWLQALLKIYDCLQEFKEKKLVPATPHAQVLSYEVVELLRETPTSPEIQE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MPP4 (NP_149055, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 58538

Enviar uma mensagem


MPP4 polyclonal antibody (A01)

MPP4 polyclonal antibody (A01)