C6orf115 monoclonal antibody (M01), clone 1G12-1D7
  • C6orf115 monoclonal antibody (M01), clone 1G12-1D7

C6orf115 monoclonal antibody (M01), clone 1G12-1D7

Ref: AB-H00058527-M01
C6orf115 monoclonal antibody (M01), clone 1G12-1D7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant C6orf115.
Información adicional
Size 100 ug
Gene Name C6orf115
Gene Alias HSPC280|PRO2013
Gene Description chromosome 6 open reading frame 115
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C6orf115 (AAH14953, 1 a.a. ~ 81 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 58527
Clone Number 1G12-1D7
Iso type IgG1 kappa

Enviar uma mensagem


C6orf115 monoclonal antibody (M01), clone 1G12-1D7

C6orf115 monoclonal antibody (M01), clone 1G12-1D7