DNASE2B polyclonal antibody (A01)
  • DNASE2B polyclonal antibody (A01)

DNASE2B polyclonal antibody (A01)

Ref: AB-H00058511-A01
DNASE2B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DNASE2B.
Información adicional
Size 50 uL
Gene Name DNASE2B
Gene Alias DLAD
Gene Description deoxyribonuclease II beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESCK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DNASE2B (NP_067056, 258 a.a. ~ 357 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 58511

Enviar uma mensagem


DNASE2B polyclonal antibody (A01)

DNASE2B polyclonal antibody (A01)