PRUNE purified MaxPab rabbit polyclonal antibody (D01P)
  • PRUNE purified MaxPab rabbit polyclonal antibody (D01P)

PRUNE purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00058497-D01P
PRUNE purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRUNE protein.
Información adicional
Size 100 ug
Gene Name PRUNE
Gene Alias DRES-17|HTCD37
Gene Description prune homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MEDYLQGCRAALQESRPLHVVLGNEACDLDSTVSALALAFYLAKTTEAEEVFVPVLNIKRSELPLRGDIVFFLQKVHIPESILIFRDEIDLHALYQAGQLTLILVDHHILSKSDTALEEAVAEVLDHRPIEPKHCPPCHVSVELVGSCATLVTERILQGAPEILDRQTAALLHGTIILDCVNMDLKIGKATPKDSKYVEKLEALFPDLPKRNDIFDSLQKAKFDVSGLTTEQMLRKDQKTIYRQGVKVAISAIYM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRUNE (NP_067045.1, 1 a.a. ~ 453 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 58497

Enviar uma mensagem


PRUNE purified MaxPab rabbit polyclonal antibody (D01P)

PRUNE purified MaxPab rabbit polyclonal antibody (D01P)