PLEKHB1 polyclonal antibody (A01)
  • PLEKHB1 polyclonal antibody (A01)

PLEKHB1 polyclonal antibody (A01)

Ref: AB-H00058473-A01
PLEKHB1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PLEKHB1.
Información adicional
Size 50 uL
Gene Name PLEKHB1
Gene Alias KPL1|PHR1|PHRET1
Gene Description pleckstrin homology domain containing, family B (evectins) member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VPPDSALESPFEEMALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVLIHFNVRDIKIGPECHDVQPPEGRSRDGLLTVNLREGGRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLEKHB1 (NP_067023, 7 a.a. ~ 106 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 58473

Enviar uma mensagem


PLEKHB1 polyclonal antibody (A01)

PLEKHB1 polyclonal antibody (A01)