TSCOT monoclonal antibody (M06), clone 2F7
  • TSCOT monoclonal antibody (M06), clone 2F7

TSCOT monoclonal antibody (M06), clone 2F7

Ref: AB-H00057864-M06
TSCOT monoclonal antibody (M06), clone 2F7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TSCOT.
Información adicional
Size 100 ug
Gene Name SLC46A2
Gene Alias Ly110|TSCOT
Gene Description solute carrier family 46, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LKVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPHKTT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TSCOT (NP_149040, 227 a.a. ~ 282 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57864
Clone Number 2F7
Iso type IgG2a Kappa

Enviar uma mensagem


TSCOT monoclonal antibody (M06), clone 2F7

TSCOT monoclonal antibody (M06), clone 2F7