CADM3 purified MaxPab rabbit polyclonal antibody (D01P)
  • CADM3 purified MaxPab rabbit polyclonal antibody (D01P)

CADM3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00057863-D01P
CADM3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CADM3 protein.
Información adicional
Size 100 ug
Gene Name CADM3
Gene Alias BIgR|FLJ10698|IGSF4B|NECL1|Necl-1|TSLL1|synCAM3
Gene Description cell adhesion molecule 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGAPAASLLLLLLLFACCWAPGGANLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CADM3 (AAH33819.1, 1 a.a. ~ 398 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57863

Enviar uma mensagem


CADM3 purified MaxPab rabbit polyclonal antibody (D01P)

CADM3 purified MaxPab rabbit polyclonal antibody (D01P)