LSM2 purified MaxPab mouse polyclonal antibody (B01P)
  • LSM2 purified MaxPab mouse polyclonal antibody (B01P)

LSM2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057819-B01P
LSM2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LSM2 protein.
Información adicional
Size 50 ug
Gene Name LSM2
Gene Alias C6orf28|G7b|YBL026W|snRNP
Gene Description LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LSM2 (ABM87538.1, 1 a.a. ~ 95 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57819

Enviar uma mensagem


LSM2 purified MaxPab mouse polyclonal antibody (B01P)

LSM2 purified MaxPab mouse polyclonal antibody (B01P)