KIAA1967 purified MaxPab rabbit polyclonal antibody (D01P)
  • KIAA1967 purified MaxPab rabbit polyclonal antibody (D01P)

KIAA1967 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00057805-D01P
KIAA1967 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KIAA1967 protein.
Información adicional
Size 100 ug
Gene Name KIAA1967
Gene Alias DBC-1|DBC1
Gene Description KIAA1967
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSQFKRQRINPLPGGRNFSGTASTSLLGPPPGLLTPPVATELSQNARHLQGGEKQRVFTGIVTSLHDYFGVVDEEVFFQLSVVKGRLPQLGEKVLVKAAYNPGQAVPWNAVKVQTLSNQPLLKSPAPPLLHVAALGQKQGILGAQPQLIFQPHRIPPLFPQKPLSLFQTSHTLHLSHLNRFPARGPHGRLDQGRSDDYDSKKRKQRAGGEPWGAKKPRHDLPPYRVHLTPYTVDSPICDFLELQRRYRSLLVPSD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KIAA1967 (NP_066997.3, 1 a.a. ~ 923 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57805

Enviar uma mensagem


KIAA1967 purified MaxPab rabbit polyclonal antibody (D01P)

KIAA1967 purified MaxPab rabbit polyclonal antibody (D01P)