POLD4 monoclonal antibody (M10), clone 2C11
  • POLD4 monoclonal antibody (M10), clone 2C11

POLD4 monoclonal antibody (M10), clone 2C11

Ref: AB-H00057804-M10
POLD4 monoclonal antibody (M10), clone 2C11

Información del producto

Mouse monoclonal antibody raised against a full length recombinant POLD4.
Información adicional
Size 100 ug
Gene Name POLD4
Gene Alias POLDS|p12
Gene Description polymerase (DNA-directed), delta 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57804
Clone Number 2C11
Iso type IgG2a Kappa

Enviar uma mensagem


POLD4 monoclonal antibody (M10), clone 2C11

POLD4 monoclonal antibody (M10), clone 2C11