POLD4 monoclonal antibody (M01A), clone 2B11
  • POLD4 monoclonal antibody (M01A), clone 2B11

POLD4 monoclonal antibody (M01A), clone 2B11

Ref: AB-H00057804-M01A
POLD4 monoclonal antibody (M01A), clone 2B11

Información del producto

Mouse monoclonal antibody raised against a full length recombinant POLD4.
Información adicional
Size 200 uL
Gene Name POLD4
Gene Alias POLDS|p12
Gene Description polymerase (DNA-directed), delta 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 57804
Clone Number 2B11
Iso type IgG2b kappa

Enviar uma mensagem


POLD4 monoclonal antibody (M01A), clone 2B11

POLD4 monoclonal antibody (M01A), clone 2B11