HES4 purified MaxPab mouse polyclonal antibody (B01P)
  • HES4 purified MaxPab mouse polyclonal antibody (B01P)

HES4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057801-B01P
HES4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HES4 protein.
Información adicional
Size 50 ug
Gene Name HES4
Gene Alias bHLHb42
Gene Description hairy and enhancer of split 4 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLAPPLLPGLTRALPAAPRAGPQGPGGPWRPWLR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HES4 (NP_066993.1, 1 a.a. ~ 221 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57801

Enviar uma mensagem


HES4 purified MaxPab mouse polyclonal antibody (B01P)

HES4 purified MaxPab mouse polyclonal antibody (B01P)