GATAD1 purified MaxPab mouse polyclonal antibody (B01P)
  • GATAD1 purified MaxPab mouse polyclonal antibody (B01P)

GATAD1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057798-B01P
GATAD1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GATAD1 protein.
Información adicional
Size 50 ug
Gene Name GATAD1
Gene Alias FLJ22489|FLJ40695|ODAG|RG083M05.2
Gene Description GATA zinc finger domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGRGGAGSGGAGSGAAGGTGGSGGGGFGAATFASTSATPPQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSSPRDQFDPASYIIGPEEDLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GATAD1 (NP_066990.3, 1 a.a. ~ 269 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57798

Enviar uma mensagem


GATAD1 purified MaxPab mouse polyclonal antibody (B01P)

GATAD1 purified MaxPab mouse polyclonal antibody (B01P)