TRIB3 purified MaxPab mouse polyclonal antibody (B01P)
  • TRIB3 purified MaxPab mouse polyclonal antibody (B01P)

TRIB3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057761-B01P
TRIB3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRIB3 protein.
Información adicional
Size 50 ug
Gene Name TRIB3
Gene Alias C20orf97|NIPK|SINK|SKIP3|TRB3
Gene Description tribbles homolog 3 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAVATASRLGPYVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMHSLVRSRHRIPEPEAAVLFRQMATALAHCHQHGLVLRDLKLCRFVFADRERKKLVLENLEDSCVLTGPDDSLWDKHACPAYVGPEILSSRASYSGKAADVWSLGVALFTML
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRIB3 (NP_066981.2, 1 a.a. ~ 358 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57761

Enviar uma mensagem


TRIB3 purified MaxPab mouse polyclonal antibody (B01P)

TRIB3 purified MaxPab mouse polyclonal antibody (B01P)