NCOA5 monoclonal antibody (M04), clone 1E9
  • NCOA5 monoclonal antibody (M04), clone 1E9

NCOA5 monoclonal antibody (M04), clone 1E9

Ref: AB-H00057727-M04
NCOA5 monoclonal antibody (M04), clone 1E9

Información del producto

Mouse monoclonal antibody raised against a full length recombinant NCOA5.
Información adicional
Size 100 ug
Gene Name NCOA5
Gene Alias CIA|bA465L10.6
Gene Description nuclear receptor coactivator 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MAGMPGTAETFETPETCGTTDMRDSRDPMYRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NCOA5 (AAH56872, 1 a.a. ~ 315 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57727
Clone Number 1E9
Iso type IgG2b Kappa

Enviar uma mensagem


NCOA5 monoclonal antibody (M04), clone 1E9

NCOA5 monoclonal antibody (M04), clone 1E9