SEMA4G purified MaxPab mouse polyclonal antibody (B02P)
  • SEMA4G purified MaxPab mouse polyclonal antibody (B02P)

SEMA4G purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00057715-B02P
SEMA4G purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SEMA4G protein.
Información adicional
Size 50 ug
Gene Name SEMA4G
Gene Alias FLJ20590|KIAA1619|MGC102867
Gene Description sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4G
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGSMSPPSAWPCVLDGPETRQDLCQPPKPCVHSHAHMEECLSAGLQCPHPHLLLVHSCFIPASGLGVPSQLPHPIWSSSPAPCGDLFVKSLGTGQPGEVRLHHSPPLPSCVALVNQPPHSPWSFSRV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SEMA4G (AAH20960.1, 1 a.a. ~ 127 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57715

Enviar uma mensagem


SEMA4G purified MaxPab mouse polyclonal antibody (B02P)

SEMA4G purified MaxPab mouse polyclonal antibody (B02P)