MAGEE1 purified MaxPab mouse polyclonal antibody (B02P)
  • MAGEE1 purified MaxPab mouse polyclonal antibody (B02P)

MAGEE1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00057692-B02P
MAGEE1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MAGEE1 protein.
Información adicional
Size 50 ug
Gene Name MAGEE1
Gene Alias DAMAGE|HCA1|KIAA1587
Gene Description melanoma antigen family E, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSLVSQNSRRRRRRVAKATAHNSSWGEMQAPNAPGLPADVPGSDVPQGPSDSQILQGLCASEGPSTSVLPTSAEGPSTFVPPTISEASSASGQPTISEGPGTSVLPTPSEGLSTSGPPTISKGLCTSVTLAASEGRNTSRPPTSSEEPSTSVPPTASEVPSTSLPPTPGEGTSTSVPPTAYEGPSTSVVPTPDEGPSTSVLPTPGEGPGTSVPLAATEGLSTSVQATPDEGPSTSVPPTATEGLSTPVPPTRDEG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MAGEE1 (AAH50588.1, 1 a.a. ~ 957 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57692

Enviar uma mensagem


MAGEE1 purified MaxPab mouse polyclonal antibody (B02P)

MAGEE1 purified MaxPab mouse polyclonal antibody (B02P)