CHD8 polyclonal antibody (A01)
  • CHD8 polyclonal antibody (A01)

CHD8 polyclonal antibody (A01)

Ref: AB-H00057680-A01
CHD8 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CHD8.
Información adicional
Size 50 uL
Gene Name CHD8
Gene Alias DKFZp686N17164|HELSNF1|KIAA1564
Gene Description chromodomain helicase DNA binding protein 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EGLKLTFQKHKLMANGVMGDGHPLFHKKKGNRKKLVELEVECMEEPNHLDVDLETRIPVINKVDGTLLVGEDAPRRAELEMWLQGHPEFAVDPRFLAYM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHD8 (NP_065971, 1980 a.a. ~ 2078 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57680

Enviar uma mensagem


CHD8 polyclonal antibody (A01)

CHD8 polyclonal antibody (A01)