GPAM purified MaxPab rabbit polyclonal antibody (D01P)
  • GPAM purified MaxPab rabbit polyclonal antibody (D01P)

GPAM purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00057678-D01P
GPAM purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GPAM protein.
Información adicional
Size 100 ug
Gene Name GPAM
Gene Alias GPAT1|KIAA1560|MGC26846|RP11-426E5.2
Gene Description glycerol-3-phosphate acyltransferase, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDEYALTLGTIDVSYLPHSSEYSVGRCKHTSEEWGECGFRPTIFRSATLKWKESLMSRKRPFVGRCCYSCTPQSWDKFFNTSIPSLGLRNVIYINETHTRHRGWLARRLSYVLFIQERDVHKGMFATNVTENVLNSSRVQEAIAEVAAELNPDGSAQQQSKAVNKVKKKAKRILQEMVATVSPAMIRLTGWVLLKLFNSFFWNIQIHKGQLEMVKAATETNLPLLFLPVHRSHIDYLLLTFILFCHNIKAPYIAS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GPAM (AAH30783.1, 1 a.a. ~ 828 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57678

Enviar uma mensagem


GPAM purified MaxPab rabbit polyclonal antibody (D01P)

GPAM purified MaxPab rabbit polyclonal antibody (D01P)