GPAM polyclonal antibody (A01)
  • GPAM polyclonal antibody (A01)

GPAM polyclonal antibody (A01)

Ref: AB-H00057678-A01
GPAM polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GPAM.
Información adicional
Size 50 uL
Gene Name GPAM
Gene Alias GPAT1|KIAA1560|MGC26846|RP11-426E5.2
Gene Description glycerol-3-phosphate acyltransferase, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PEYLQKLHKYLITRTERNVAVYAESATYCLVKNAVKMFKDIGVFKETKQKRVSVLELSSTFLPQCNRQKLLEYILSFVVL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GPAM (NP_065969, 749 a.a. ~ 828 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57678

Enviar uma mensagem


GPAM polyclonal antibody (A01)

GPAM polyclonal antibody (A01)