C17orf27 polyclonal antibody (A01)
  • C17orf27 polyclonal antibody (A01)

C17orf27 polyclonal antibody (A01)

Ref: AB-H00057674-A01
C17orf27 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant C17orf27.
Información adicional
Size 50 uL
Gene Name RNF213
Gene Alias C17orf27|KIAA1554
Gene Description ring finger protein 213
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LSPENAKLLSTFLNQTGLDAFLLELHEMIILKLKNPQTQTEERFRPQWSLRDTLVSYMQTKESEILPEMASQFPEEILLASCVSVWKTAAVLKWNRE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C17orf27 (NP_065965, 2016 a.a. ~ 2112 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57674

Enviar uma mensagem


C17orf27 polyclonal antibody (A01)

C17orf27 polyclonal antibody (A01)