PLEKHA4 purified MaxPab mouse polyclonal antibody (B01P)
  • PLEKHA4 purified MaxPab mouse polyclonal antibody (B01P)

PLEKHA4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057664-B01P
PLEKHA4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PLEKHA4 protein.
Información adicional
Size 50 ug
Gene Name PLEKHA4
Gene Alias PEPP1
Gene Description pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEGSRPRSSLSLASSASTISSLSSLSPKKPTRAVNKVHAFGKRGNALRRDPNLPVHIRGWLHKQDSSGLRLWKRRWFVLSGHCLFYYKDSREESVLGSVLLPSYNIRPDGPGAPRGRRFTFTAEHPGMRTYVLAADTLEDLRGWLRALGRASRAEGDDYGQPRSPARPQPGEGPGGPGGPPEVSRGEEGRISESPEVTRLSRGRGRPRLLTPSPTTDLHSGLQMRRARSPDLFTPLSRPPSPLSLPRPRSAPARR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLEKHA4 (AAH64601.1, 1 a.a. ~ 583 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57664

Enviar uma mensagem


PLEKHA4 purified MaxPab mouse polyclonal antibody (B01P)

PLEKHA4 purified MaxPab mouse polyclonal antibody (B01P)