EP400 purified MaxPab mouse polyclonal antibody (B01P)
  • EP400 purified MaxPab mouse polyclonal antibody (B01P)

EP400 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057634-B01P
EP400 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EP400 protein.
Información adicional
Size 50 ug
Gene Name EP400
Gene Alias CAGH32|DKFZP434I225|FLJ42018|FLJ45115|P400|TNRC12
Gene Description E1A binding protein p400
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MHHGTGPQNVQHQLQRSRACPGSEGEEQPAHPNPPPSPAAPFAPSASPSAPQSPSYQIQQLMNRSPATGQNVNITLQSVGPVVGGNQQITLAPLPLPSPTSPGFQFSAQPRRFEHGSPSYIQVTSPLSQQVQTQSPTQPSPGPGQALQNVRAGAPGPGLGLCSSSPTGGFVDASVLVRQISLSPSSGGHFVFQDGSGLTQIAQGAQVQLQHPGTPITVRERRPSQPHTQSGGTIHHLGPQSPAAAGGAGLQPLAS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EP400 (AAH37208.1, 1 a.a. ~ 985 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57634

Enviar uma mensagem


EP400 purified MaxPab mouse polyclonal antibody (B01P)

EP400 purified MaxPab mouse polyclonal antibody (B01P)