SH3MD2 monoclonal antibody (M01), clone 3H3
  • SH3MD2 monoclonal antibody (M01), clone 3H3

SH3MD2 monoclonal antibody (M01), clone 3H3

Ref: AB-H00057630-M01
SH3MD2 monoclonal antibody (M01), clone 3H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SH3MD2.
Información adicional
Size 100 ug
Gene Name SH3RF1
Gene Alias FLJ21602|KIAA1494|POSH|RNF142|SH3MD2
Gene Description SH3 domain containing ring finger 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LAQDAFHRKASSLDSAVPIAPPPRQACSSLGPVLNESRPVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SH3MD2 (NP_065921, 790 a.a. ~ 888 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57630
Clone Number 3H3
Iso type IgG2a Kappa

Enviar uma mensagem


SH3MD2 monoclonal antibody (M01), clone 3H3

SH3MD2 monoclonal antibody (M01), clone 3H3