Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
VPS18 monoclonal antibody (M04), clone 4E9
Abnova
VPS18 monoclonal antibody (M04), clone 4E9
Ref: AB-H00057617-M04
VPS18 monoclonal antibody (M04), clone 4E9
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant VPS18.
Información adicional
Size
100 ug
Gene Name
VPS18
Gene Alias
KIAA1475|PEP3
Gene Description
vacuolar protein sorting 18 homolog (S. cerevisiae)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,IP,ELISA
Immunogen Prot. Seq
SILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKV
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
VPS18 (NP_065908, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
57617
Clone Number
4E9
Iso type
IgG3 Kappa
Enviar uma mensagem
VPS18 monoclonal antibody (M04), clone 4E9
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*