VPS18 monoclonal antibody (M01), clone 4F8
  • VPS18 monoclonal antibody (M01), clone 4F8

VPS18 monoclonal antibody (M01), clone 4F8

Ref: AB-H00057617-M01
VPS18 monoclonal antibody (M01), clone 4F8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant VPS18.
Información adicional
Size 100 ug
Gene Name VPS18
Gene Alias KIAA1475|PEP3
Gene Description vacuolar protein sorting 18 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VPS18 (NP_065908, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57617
Clone Number 4F8
Iso type IgG3 Kappa

Enviar uma mensagem


VPS18 monoclonal antibody (M01), clone 4F8

VPS18 monoclonal antibody (M01), clone 4F8