EBF4 monoclonal antibody (M04), clone 4E10
  • EBF4 monoclonal antibody (M04), clone 4E10

EBF4 monoclonal antibody (M04), clone 4E10

Ref: AB-H00057593-M04
EBF4 monoclonal antibody (M04), clone 4E10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant EBF4.
Información adicional
Size 100 ug
Gene Name EBF4
Gene Alias COE4|KIAA1442|O/E-4
Gene Description early B-cell factor 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MPSSPPLAAASSMSLPAAAPTTSVFSFSPVNMISAVKQRSAFAPVLRPPSSPPQACPRAHGEGLPDQSFEDSDKFHSPARGLQGLAYS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EBF4 (AAH54347.1, 1 a.a. ~ 88 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57593
Clone Number 4E10
Iso type IgG2a Kappa

Enviar uma mensagem


EBF4 monoclonal antibody (M04), clone 4E10

EBF4 monoclonal antibody (M04), clone 4E10