EBF4 MaxPab mouse polyclonal antibody (B01P)
  • EBF4 MaxPab mouse polyclonal antibody (B01P)

EBF4 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057593-B01P
EBF4 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EBF4 protein.
Información adicional
Size 50 ug
Gene Name EBF4
Gene Alias COE4|KIAA1442|O/E-4
Gene Description early B-cell factor 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPSSPPLAAASSMSLPAAAPTTSVFSFSPVNMISAVKQRSAFAPVLRPPSSPPQACPRAHGEGLPDQSFEDSDKFHSPARGLQGLAYS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EBF4 (AAH54347.1, 1 a.a. ~ 88 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57593

Enviar uma mensagem


EBF4 MaxPab mouse polyclonal antibody (B01P)

EBF4 MaxPab mouse polyclonal antibody (B01P)