SYT13 monoclonal antibody (M04), clone 1H3
  • SYT13 monoclonal antibody (M04), clone 1H3

SYT13 monoclonal antibody (M04), clone 1H3

Ref: AB-H00057586-M04
SYT13 monoclonal antibody (M04), clone 1H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SYT13.
Información adicional
Size 100 ug
Gene Name SYT13
Gene Alias KIAA1427
Gene Description synaptotagmin XIII
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KKGLLPRDQDPDLEKAKPSLLGSAQQFNVKKSTEPVQPRALLKFPDIYGPRPAVTAPEVINYADYSLRSTEEPTAPASPQPPNDSRLKRQVTEELFILPQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SYT13 (NP_065877.1, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57586
Clone Number 1H3
Iso type IgG2a Kappa

Enviar uma mensagem


SYT13 monoclonal antibody (M04), clone 1H3

SYT13 monoclonal antibody (M04), clone 1H3