PCDH10 purified MaxPab mouse polyclonal antibody (B01P)
  • PCDH10 purified MaxPab mouse polyclonal antibody (B01P)

PCDH10 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057575-B01P
PCDH10 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PCDH10 protein.
Información adicional
Size 50 ug
Gene Name PCDH10
Gene Alias DKFZp761O2023|KIAA1400|MGC133344|OL-PCDH|PCDH19
Gene Description protocadherin 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MIVLLLFALLWMVEGVFSQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTVPNSRTPYLDLNLETGVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFQVEIEVLDINDNPPSFPEPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEITPNSYFSLDVQTQGDGNRFAELVLEKPLDREQQAVHRYVLTAVDGGGGGGVGEGGGGGGGAGLPPQQQRTGTALLTIRVLDSNDNVPAFDQPVY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PCDH10 (NP_116586.1, 1 a.a. ~ 1040 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57575

Enviar uma mensagem


PCDH10 purified MaxPab mouse polyclonal antibody (B01P)

PCDH10 purified MaxPab mouse polyclonal antibody (B01P)