PCDH10 polyclonal antibody (A01)
  • PCDH10 polyclonal antibody (A01)

PCDH10 polyclonal antibody (A01)

Ref: AB-H00057575-A01
PCDH10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCDH10.
Información adicional
Size 50 uL
Gene Name PCDH10
Gene Alias DKFZp761O2023|KIAA1400|MGC133344|OL-PCDH|PCDH19
Gene Description protocadherin 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTVPNSRTPYLDLNLETGVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFQVEIEVLDINDNPPSFPEPDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDH10 (NP_065866, 18 a.a. ~ 127 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57575

Enviar uma mensagem


PCDH10 polyclonal antibody (A01)

PCDH10 polyclonal antibody (A01)