MARCH4 polyclonal antibody (A01)
  • MARCH4 polyclonal antibody (A01)

MARCH4 polyclonal antibody (A01)

Ref: AB-H00057574-A01
MARCH4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MARCH4.
Información adicional
Size 50 uL
Gene Name MARCH4
Gene Alias MARCH-IV|MGC104908|RNF174
Gene Description membrane-associated ring finger (C3HC4) 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KDLEDQKAGGRTNPRTSSSTQANIPSSEEETAGTPAPEQGPAQAAGHPSGPLSHHHCAYTILHILSHLRPHEQRSPPGSSRELVMRVTTV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen 40972 (NP_065865, 321 a.a. ~ 410 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57574

Enviar uma mensagem


MARCH4 polyclonal antibody (A01)

MARCH4 polyclonal antibody (A01)