ZNF319 purified MaxPab mouse polyclonal antibody (B01P)
  • ZNF319 purified MaxPab mouse polyclonal antibody (B01P)

ZNF319 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057567-B01P
ZNF319 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF319 protein.
Información adicional
Size 50 ug
Gene Name ZNF319
Gene Alias MGC126816|ZFP319
Gene Description zinc finger protein 319
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSESWQQPPQTQPQQPQPPQPQHHAEPPPALAEHTLPPGTAENPLGCAVYGILLQPDPGLQPPQHAPLQAAGEPGPKCGVCGHDLAHLSSPHEHQCLAGHDRSFQCTQCLKIFHQATDLLEHQCVQAEQKPFVCGVCKMGFSLLTSLAQHHSSHSGLVKCSICEKTYKPAEAAEPATTAAPSLPAAPAPSTVTPAEQADKPYSCPICQKPFKHLSELSRHERIHTGEKPYKCTLCDKSFSQSSHLVHHKRTHSSE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF319 (NP_065858.1, 1 a.a. ~ 582 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57567

Enviar uma mensagem


ZNF319 purified MaxPab mouse polyclonal antibody (B01P)

ZNF319 purified MaxPab mouse polyclonal antibody (B01P)