PDP2 purified MaxPab mouse polyclonal antibody (B01P)
  • PDP2 purified MaxPab mouse polyclonal antibody (B01P)

PDP2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057546-B01P
PDP2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PDP2 protein.
Información adicional
Size 50 ug
Gene Name PDP2
Gene Alias KIAA1348
Gene Description pyruvate dehydrogenase phosphatase isoenzyme 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSSTVSYWILNSTRNSIATLQGGRRLYSRYVSNRNKLKWRLFSRVPPTLNSSPCGGFTLCKAYRHTSTEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIFDGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PDP2 (NP_065837.1, 1 a.a. ~ 529 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57546

Enviar uma mensagem


PDP2 purified MaxPab mouse polyclonal antibody (B01P)

PDP2 purified MaxPab mouse polyclonal antibody (B01P)