SORCS2 polyclonal antibody (A01)
  • SORCS2 polyclonal antibody (A01)

SORCS2 polyclonal antibody (A01)

Ref: AB-H00057537-A01
SORCS2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SORCS2.
Información adicional
Size 50 uL
Gene Name SORCS2
Gene Alias -
Gene Description sortilin-related VPS10 domain containing receptor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VLRVLDQFQVMPLQFSKELDAYNPNTPEWREDVGLVVTRLLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAAIQQVLNAQKI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SORCS2 (NP_065828.1, 802 a.a. ~ 900 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57537

Enviar uma mensagem


SORCS2 polyclonal antibody (A01)

SORCS2 polyclonal antibody (A01)