MIB1 polyclonal antibody (A01)
  • MIB1 polyclonal antibody (A01)

MIB1 polyclonal antibody (A01)

Ref: AB-H00057534-A01
MIB1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MIB1.
Información adicional
Size 50 uL
Gene Name MIB1
Gene Alias DIP-1|DKFZp686I0769|DKFZp761M1710|FLJ90676|MGC129659|MGC129660|MIB|ZZANK2|ZZZ6
Gene Description mindbomb homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MIB1 (NP_065825, 909 a.a. ~ 1006 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57534

Enviar uma mensagem


MIB1 polyclonal antibody (A01)

MIB1 polyclonal antibody (A01)