HACE1 polyclonal antibody (A01)
  • HACE1 polyclonal antibody (A01)

HACE1 polyclonal antibody (A01)

Ref: AB-H00057531-A01
HACE1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HACE1.
Información adicional
Size 50 uL
Gene Name HACE1
Gene Alias -
Gene Description HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRVPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALHCGSYGYTMA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HACE1 (NP_065822, 800 a.a. ~ 909 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57531

Enviar uma mensagem


HACE1 polyclonal antibody (A01)

HACE1 polyclonal antibody (A01)