HECW2 monoclonal antibody (M01), clone 5H1
  • HECW2 monoclonal antibody (M01), clone 5H1

HECW2 monoclonal antibody (M01), clone 5H1

Ref: AB-H00057520-M01
HECW2 monoclonal antibody (M01), clone 5H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HECW2.
Información adicional
Size 100 ug
Gene Name HECW2
Gene Alias DKFZp686M17164|NEDL2
Gene Description HECT, C2 and WW domain containing E3 ubiquitin protein ligase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DLECADSSCNESVTTQLSSVDTRCSSLESARFPETPAFSSQEEEDGACAAEPTSSGPAEGSQESVCTAGSLPVVQVPSGEDEGPGAESATVPDQEELGEVWQRRGSLEG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HECW2 (NP_065811, 637 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57520
Clone Number 5H1
Iso type IgG2b Kappa

Enviar uma mensagem


HECW2 monoclonal antibody (M01), clone 5H1

HECW2 monoclonal antibody (M01), clone 5H1