HECW2 polyclonal antibody (A01)
  • HECW2 polyclonal antibody (A01)

HECW2 polyclonal antibody (A01)

Ref: AB-H00057520-A01
HECW2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HECW2.
Información adicional
Size 50 uL
Gene Name HECW2
Gene Alias DKFZp686M17164|NEDL2
Gene Description HECT, C2 and WW domain containing E3 ubiquitin protein ligase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DLECADSSCNESVTTQLSSVDTRCSSLESARFPETPAFSSQEEEDGACAAEPTSSGPAEGSQESVCTAGSLPVVQVPSGEDEGPGAESATVPDQEELGEVWQRRGSLEG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HECW2 (NP_065811, 637 a.a. ~ 745 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57520

Enviar uma mensagem


HECW2 polyclonal antibody (A01)

HECW2 polyclonal antibody (A01)