CAMK1D monoclonal antibody (M10), clone 3H8
  • CAMK1D monoclonal antibody (M10), clone 3H8

CAMK1D monoclonal antibody (M10), clone 3H8

Ref: AB-H00057118-M10
CAMK1D monoclonal antibody (M10), clone 3H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CAMK1D.
Información adicional
Size 100 ug
Gene Name CAMK1D
Gene Alias CKLiK|CaM-K1|CaMKID
Gene Description calcium/calmodulin-dependent protein kinase ID
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CAMK1D (NP_705718.1, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57118
Clone Number 3H8
Iso type IgG2b Kappa

Enviar uma mensagem


CAMK1D monoclonal antibody (M10), clone 3H8

CAMK1D monoclonal antibody (M10), clone 3H8